portrait shot of dead open mouth with gasmask in the front in a scenic dystopian environment, intricate, elegant, highly detailed, centered, digital painting, artstation, concept art, smooth, sharp focus, illustration, artgerm, tomasz alen kopera, peter mohrbacher, SKULL , joseph christian leyendecker, wlop, boris vallejo
058
Stable Diffusion
A photorealistic image of a {{lungs}} leaf shaped like {{Lungs}}. The leaf should be detailed, with veins and textures resembling a real leaf. The shape should mimic the silhouette of a {{lungs}}, including the curves and form of the body, but entirely composed of leafy textures and colors. The background should be plain to highlight the unique leaf shape
7208
DALL·E
An ultra-realistic portrayal capturing Bacillus anthracis within the extracellular protein environment, intricately interwoven with the amino acid sequence. This hyper-realistic composition captures the intricate details of Bacillus anthracis thriving within its extracellular protein domain. written around the text: GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSETRTISKNTSTSRTHT SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV
140
DreamShaper
A full body full face shot of a scary creepy human, state of decay and brittle, frail, sneezing, raptured dried dead body, lost in wild forest, rustic old prosthetics, covered in lush, mold, fungus, cracked face, wild flowers and nature, moss, hyper realistic, highly detailed, depth of field, aura of power, renaissance painting, <lora:ral-dissolve:1> ral-dissolve
180
Openjourney
1 girl, transparent respirator on face, flowers growing out of girl's mouth, flowers growing on respirator, flowers coming down her hair, white flower, blue flower, flower crown, yellow glow from respirator, spores in the air, post-apocalypse, dust in background, dust in the air, long hair, portrait, solo, vines, brown hair, closed eyes, face, facial hair, flower, leaf, face turned to left
2135
DreamShaper
portrait shot of dead open mouth with gasmask in the front in a scenic dystopian environment, intricate, elegant, highly detailed, centered, digital painting, artstation, concept art, smooth, sharp focus, illustration, artgerm, tomasz alen kopera, peter mohrbacher, SKULL , joseph christian leyendecker, wlop, boris vallejo
058
Stable Diffusion
An ultra-realistic portrayal capturing Bacillus anthracis within the extracellular protein environment, intricately interwoven with the amino acid sequence. This hyper-realistic composition captures the intricate details of Bacillus anthracis thriving within its extracellular protein domain. written around the text: GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSETRTISKNTSTSRTHT SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV
140
DreamShaper
1 girl, transparent respirator on face, flowers growing out of girl's mouth, flowers growing on respirator, flowers coming down her hair, white flower, blue flower, flower crown, yellow glow from respirator, spores in the air, post-apocalypse, dust in background, dust in the air, long hair, portrait, solo, vines, brown hair, closed eyes, face, facial hair, flower, leaf, face turned to left
2135
DreamShaper
A photorealistic image of a {{lungs}} leaf shaped like {{Lungs}}. The leaf should be detailed, with veins and textures resembling a real leaf. The shape should mimic the silhouette of a {{lungs}}, including the curves and form of the body, but entirely composed of leafy textures and colors. The background should be plain to highlight the unique leaf shape
7208
DALL·E
A full body full face shot of a scary creepy human, state of decay and brittle, frail, sneezing, raptured dried dead body, lost in wild forest, rustic old prosthetics, covered in lush, mold, fungus, cracked face, wild flowers and nature, moss, hyper realistic, highly detailed, depth of field, aura of power, renaissance painting, <lora:ral-dissolve:1> ral-dissolve
180
Openjourney
A full body full face shot of a scary creepy human, state of decay and brittle, frail, sneezing, raptured dried dead body, lost in wild forest, rustic old prosthetics, covered in lush, mold, fungus, cracked face, wild flowers and nature, moss, hyper realistic, highly detailed, depth of field, aura of power, renaissance painting, <lora:ral-dissolve:1> ral-dissolve
180
Openjourney
portrait shot of dead open mouth with gasmask in the front in a scenic dystopian environment, intricate, elegant, highly detailed, centered, digital painting, artstation, concept art, smooth, sharp focus, illustration, artgerm, tomasz alen kopera, peter mohrbacher, SKULL , joseph christian leyendecker, wlop, boris vallejo
058
Stable Diffusion
An ultra-realistic portrayal capturing Bacillus anthracis within the extracellular protein environment, intricately interwoven with the amino acid sequence. This hyper-realistic composition captures the intricate details of Bacillus anthracis thriving within its extracellular protein domain. written around the text: GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSETRTISKNTSTSRTHT SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV
140
DreamShaper
A photorealistic image of a {{lungs}} leaf shaped like {{Lungs}}. The leaf should be detailed, with veins and textures resembling a real leaf. The shape should mimic the silhouette of a {{lungs}}, including the curves and form of the body, but entirely composed of leafy textures and colors. The background should be plain to highlight the unique leaf shape
7208
DALL·E
1 girl, transparent respirator on face, flowers growing out of girl's mouth, flowers growing on respirator, flowers coming down her hair, white flower, blue flower, flower crown, yellow glow from respirator, spores in the air, post-apocalypse, dust in background, dust in the air, long hair, portrait, solo, vines, brown hair, closed eyes, face, facial hair, flower, leaf, face turned to left
2135
DreamShaper
A photorealistic image of a {{lungs}} leaf shaped like {{Lungs}}. The leaf should be detailed, with veins and textures resembling a real leaf. The shape should mimic the silhouette of a {{lungs}}, including the curves and form of the body, but entirely composed of leafy textures and colors. The background should be plain to highlight the unique leaf shape
7208
DALL·E
1 girl, transparent respirator on face, flowers growing out of girl's mouth, flowers growing on respirator, flowers coming down her hair, white flower, blue flower, flower crown, yellow glow from respirator, spores in the air, post-apocalypse, dust in background, dust in the air, long hair, portrait, solo, vines, brown hair, closed eyes, face, facial hair, flower, leaf, face turned to left
2135
DreamShaper
portrait shot of dead open mouth with gasmask in the front in a scenic dystopian environment, intricate, elegant, highly detailed, centered, digital painting, artstation, concept art, smooth, sharp focus, illustration, artgerm, tomasz alen kopera, peter mohrbacher, SKULL , joseph christian leyendecker, wlop, boris vallejo
058
Stable Diffusion
A full body full face shot of a scary creepy human, state of decay and brittle, frail, sneezing, raptured dried dead body, lost in wild forest, rustic old prosthetics, covered in lush, mold, fungus, cracked face, wild flowers and nature, moss, hyper realistic, highly detailed, depth of field, aura of power, renaissance painting, <lora:ral-dissolve:1> ral-dissolve
180
Openjourney
An ultra-realistic portrayal capturing Bacillus anthracis within the extracellular protein environment, intricately interwoven with the amino acid sequence. This hyper-realistic composition captures the intricate details of Bacillus anthracis thriving within its extracellular protein domain. written around the text: GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSETRTISKNTSTSRTHT SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV
140
DreamShaper
1 girl, transparent respirator on face, flowers growing out of girl's mouth, flowers growing on respirator, flowers coming down her hair, white flower, blue flower, flower crown, yellow glow from respirator, spores in the air, post-apocalypse, dust in background, dust in the air, long hair, portrait, solo, vines, brown hair, closed eyes, face, facial hair, flower, leaf, face turned to left
2135
DreamShaper
A photorealistic image of a {{lungs}} leaf shaped like {{Lungs}}. The leaf should be detailed, with veins and textures resembling a real leaf. The shape should mimic the silhouette of a {{lungs}}, including the curves and form of the body, but entirely composed of leafy textures and colors. The background should be plain to highlight the unique leaf shape
7208
DALL·E
A full body full face shot of a scary creepy human, state of decay and brittle, frail, sneezing, raptured dried dead body, lost in wild forest, rustic old prosthetics, covered in lush, mold, fungus, cracked face, wild flowers and nature, moss, hyper realistic, highly detailed, depth of field, aura of power, renaissance painting, <lora:ral-dissolve:1> ral-dissolve
180
Openjourney
An ultra-realistic portrayal capturing Bacillus anthracis within the extracellular protein environment, intricately interwoven with the amino acid sequence. This hyper-realistic composition captures the intricate details of Bacillus anthracis thriving within its extracellular protein domain. written around the text: GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSETRTISKNTSTSRTHT SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV
140
DreamShaper
portrait shot of dead open mouth with gasmask in the front in a scenic dystopian environment, intricate, elegant, highly detailed, centered, digital painting, artstation, concept art, smooth, sharp focus, illustration, artgerm, tomasz alen kopera, peter mohrbacher, SKULL , joseph christian leyendecker, wlop, boris vallejo
058
Stable Diffusion
1 girl, transparent respirator on face, flowers growing out of girl's mouth, flowers growing on respirator, flowers coming down her hair, white flower, blue flower, flower crown, yellow glow from respirator, spores in the air, post-apocalypse, dust in background, dust in the air, long hair, portrait, solo, vines, brown hair, closed eyes, face, facial hair, flower, leaf, face turned to left
2135
DreamShaper
portrait shot of dead open mouth with gasmask in the front in a scenic dystopian environment, intricate, elegant, highly detailed, centered, digital painting, artstation, concept art, smooth, sharp focus, illustration, artgerm, tomasz alen kopera, peter mohrbacher, SKULL , joseph christian leyendecker, wlop, boris vallejo
058
Stable Diffusion
A full body full face shot of a scary creepy human, state of decay and brittle, frail, sneezing, raptured dried dead body, lost in wild forest, rustic old prosthetics, covered in lush, mold, fungus, cracked face, wild flowers and nature, moss, hyper realistic, highly detailed, depth of field, aura of power, renaissance painting, <lora:ral-dissolve:1> ral-dissolve
180
Openjourney
A photorealistic image of a {{lungs}} leaf shaped like {{Lungs}}. The leaf should be detailed, with veins and textures resembling a real leaf. The shape should mimic the silhouette of a {{lungs}}, including the curves and form of the body, but entirely composed of leafy textures and colors. The background should be plain to highlight the unique leaf shape
7208
DALL·E
An ultra-realistic portrayal capturing Bacillus anthracis within the extracellular protein environment, intricately interwoven with the amino acid sequence. This hyper-realistic composition captures the intricate details of Bacillus anthracis thriving within its extracellular protein domain. written around the text: GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSETRTISKNTSTSRTHT SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV
140
DreamShaper