Glutenin filament with gliadin Prompts

glutenin filament with gliadin, sketchnote style

gluten formation reaction with gliadin and glutenin

formation du gluten : la molécule de la gliadine et gluténine + ajout eau + panification = gluten, en sketchnote simple

Grain-free staple food package

Gremlin, highly detailed mattepainting in a microscopic surface, style of grid electron microscope, neuronal, white and red

غليون

печенье круглое с надписью Пшеница

Bread

печенье круглое с надписью Пшеница похожее на кекс

Blonde frau sitzt am Tisch, vor ihr liegt eine linie Mehl

brain noodles

BREAD

detailed model of glucose molecule, full molecule can be seen, colorful, vibrant color, ; 8k, intricate detail, photorealistic, realistic light, wide angle, soft background,

round cookies with the inscription Wheat 8k

all over print, rapport, pretzel, bread, toast and mermelade, color brown, pencil brush, spaciate

carne en fibras

round cookies with the inscription Wheat

An ultra-realistic portrayal capturing Bacillus anthracis within the extracellular protein environment, intricately interwoven with the amino acid sequence. This hyper-realistic composition captures the intricate details of Bacillus anthracis thriving within its extracellular protein domain. written around the text: GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSETRTISKNTSTSRTHT SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV

soybean field<lora:add-detail-xl:1.5>

It generates a very complete prompt for creating YouTube videos about healthy food, gluten-free, sugar-free and additive-free bakery items, and healthy desserts.

best quality, masterpiece, perfect background, bread, bread focus, basket, sunlight

inositol

spike blood sugar and insulin surge，high detail graphics, intricate details, Rim Lighting, Diffraction Grading

A warm and clean home-style kitchen scene showing a batch of freshly baked gluten-free chocolate cookies on a tray. Hands wearing clean gloves are placing cookies neatly onto a plate. Ingredients like almond flour, cocoa powder, and chocolate chips are visible in the background. The lighting is soft and natural, with a cozy, trust-inspiring atmosphere. Emphasize cleanliness, care, and homemade quality. Add subtle steam or shine to the cookies to highlight freshness.